Pay in 4 interest-free payments of $60.60 Learn more
Ships within 48 hours · Estimated delivery Aug 7 - Aug 12
Background:Sodium–hydrogen antiporter 3 also known as sodium–hydrogen exchanger 3 (NHE3) or solute carrier family 9 member 3 (SLC9A3) is a protein that in humans is encoded by the SLC9A3 gene
s80HER4 antibody
Conveys heme from hemoglobin to the HasR receptor which releases it into the bacterium
Tumor necrosis factor ligand 5A antibody
AA Sequence:MNLAAYYPVLLFLLVGTGLGIALVSIGKILGPNKPDSEKNAPYECGFEAFEDARMKFDVR YYLVAILFIIFDLETAFLFPWGVALREIGWPGFIAMMIFLLEFLLGFAYIWKKGGLDWE
PNLIPRP3 Antibody, FITC conjugated - Cat. #: CSB-PA018265LC01HU Small RNA-Seq Background:Sodium–hydrogen antiporter 3 also knownSize : 50ug Clone Number: Aliases: LIPR3_HUMAN antibody; Pancreatic lipase related protein 3 antibody; PL RP3 antibody; PNLIPRP3 antibody Product Type: Polyclonal Antibody Immunogen Species: Homo sapiens (Human) UniProt ID: Q17RR3 Immunogen: Recombinant Human Pancreatic lipase related protein 3 protein (201 467AA) Raised in: Rabbit Species Reactivity: Human Tested Applications: Background: Clonality: Polyclonal Isotype: IgG Purification Method:>95%,
US$ 89.99
US$ 200.00
US$ 49.99
US$ 7445.00
US$ 8750.00
US$ 4345.00
US$ 6450.00
US$ 4345.00
US$ 5495.00
US$ 5745.00
US$ 5500.00
