Pay in 4 interest-free payments of $263.20 Learn more
Ships within 48 hours · Estimated delivery Aug 7 - Aug 12
Gene Names: esxA
Target Protein Sequence: GVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFGEGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSKFHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN
"Touloupakis E
Expression Region: 501-744aa
Scientific Reports 5
Recombinant Saccharum officinarum Cytochrome b6-f complex subunit 4(petD) Hot Start PCR Gene Names: esxASize: 50 ug. Other sizes are also available. Please Inquire. Product Type: Recombinant Protein Species: Saccharum officinarum (Sugarcane) Uniprot NO.: Q6ENT3 Tag Info: The tag type will be determined during production process. Storage Buffer: Tris based buffer,50% glycerol, optimized for this protein Storage: Store at 20, for extended storage, conserve at 20 or 80. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4
US$ 114.99
US$ 64.99
US$ 54.99
US$ 74.99
US$ 44.99
